HORDB

ID: hor006456
Uniprot ID: Q28409
Protein name: Synenkephalin
Gene name: PENK
Organism: Felis catus (Cat) (Felis silvestris catus)
Family: Opioid neuropeptide precursor family
Source: Animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Felis (genus), Felinae (subfamily), Felidae (family), Feliformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0001515 opioid peptide activity; GO:0031628 opioid receptor binding
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission; GO:0007600 sensory perception
GO CC: GO:0005576 extracellular region; GO:0005886 plasma membrane; GO:0030425 dendrite; GO:0031410 cytoplasmic vesicle; GO:0034466 chromaffin granule lumen; GO:0043025 neuronal cell body; GO:0043679 axon terminus

Sequence: WETCKEFLKLSQLEIPQDGTSALRESSPEESHAL
Length: 34(1-34)
Propeptide: WETCKEFLKLSQLEIPQDGTSALRESSPEESHALRKKYGGFMKRYGGFMKKMDELYPQEPEEEAPAEILAKRYGGFMKKDAEEEEDALASSSDLLKELLGPGETETAAAPRGRDDEDVSKSHGGFMRALKGSPQLAQEAKMLQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFADSLPSDEEGESYS
Signal peptide: NA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: [Met-enkephalin]: Neuropeptide that competes with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress.
Mechanism: NA
Cross BBB: NA
Target: OPRD1
Target Unid: M3WGY8
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006456_AF2.pdb

hor006456_ESM.pdb

Mass:	444905	Formula:	C168H264N44O58S
Absent amino acids:	MNVY	Common amino acids:	E
pI:	4.24	Basic residues:	4
Polar residues:	9	Hydrophobic residues:	10
Hydrophobicity:	-72.06	Boman Index:	-7281
Half-Life:	2.8 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	2 min	Aliphatic Index	74.71
Instability Index:	7430.88	Extinction Coefficient cystines:	5500
Absorbance 280nm:	166.67